PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0172s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 453aa    MW: 49494.1 Da    PI: 7.3032
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0172s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like66.16.1e-21206257154
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                          k r++Wt eLH++F++a+e++ G++ A+P +il++m+v  Lt+++v+SHLQk++
  Kalax.0172s0014.1.p 206 KRRVNWTAELHNKFIDAIERI-GPN-AVPMEILKVMNVTWLTRANVASHLQKFK 257
                          689******************.776.**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23005.8E-56193No hitNo description
SuperFamilySSF521722.21E-961131IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.4E-794152No hitNo description
PROSITE profilePS5129410.672203261IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-20203260IPR009057Homeodomain-like
SuperFamilySSF466892.51E-13204261IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-18206258IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MPSSQQEQTI AVAADGSSPD ADNKKLDQPG SEKTCEDQDH YLSWDDLADD HAKEIPSFKI  60
DGLRVLAVDD SVVCLKILVA LLKHCKYNVL SADNNQQNIM KAIRYGARDY IIKPPGMAQI  120
KNVWQHVVRK QLFGSGCKDA NNANNSSVTI EETRSPVEDS KRKQTEIEQD DNRDDEMGKT  180
DEEAASAWTG CGNAADGSGA GAAKKKRRVN WTAELHNKFI DAIERIGPNA VPMEILKVMN  240
VTWLTRANVA SHLQKFKNAL RGQTQSAQPA RNVYNSRVNS AAGQSGYQSS LSSASPYSTG  300
AMNYGSSSSA YPVGTSQILP QRFPYQQSNL NPMIQNLGYA NQSQSHTQHY NLPFNPSAYQ  360
APTMLNDAPL PPKTVRPDIQ GHPPVPKFNG LRFPTFGTMN NNNMINSYSV NQPQLPAPTL  420
APSQPTYAYT PAVAPTSVRV ADSQQHDMLT EG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15203261261ARR10-B
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203207KKKRR
2203208KKKRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.16e-31response regulator 12